PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I00022.1.p
Common NameEUGRSUZ_I00022, LOC104417993
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family ZF-HD
Protein Properties Length: 217aa    MW: 24295.3 Da    PI: 8.6008
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I00022.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer97.11.3e-3055107457
       ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                       ++Y+eC+kNhAa++Gg+a DGCgEfmp  geegt +alkC+AC+CHRnFHRre 
  Eucgr.I00022.1.p  55 TKYRECQKNHAAAIGGNARDGCGEFMPG-GEEGTLDALKCSACNCHRNFHRREI 107
                       68*************************9.999********************96 PP

2Homeobox23.21.1e-07153208152
                       TT--SS--HHHHHHHHHHHH.....HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFe.....knrypsaeereeLAkklgLterqVkvWFqNrR 52 
                       rr Rt+ft++q e + + F+     + +++++++ e+L ++lg++ r+ kvW +N +
  Eucgr.I00022.1.p 153 RRYRTKFTAQQKEKMLA-FAtkagwRMQKLDEHAVERLCQELGIERRVLKVWMHNNK 208
                       899***********976.555888789****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257748.0E-2153107IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.1E-2855107IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.2E-2956107IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.80357106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.47E-20142210IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.5E-29146210IPR009057Homeodomain-like
PROSITE profilePS500718.762150214IPR001356Homeobox domain
TIGRFAMsTIGR015652.4E-25152208IPR006455Homeodomain, ZF-HD class
PfamPF000462.8E-5153208IPR001356Homeobox domain
CDDcd000865.91E-4153206No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MSQAGDKPMQ SSRSSSDDVD GQVLPRSPPP YIQLREDHDR KREPSLHGGE GSGVTKYREC  60
QKNHAAAIGG NARDGCGEFM PGGEEGTLDA LKCSACNCHR NFHRREILAV HPLNVDASGG  120
LTLHLLKLDP TDSPTDNDGD ETPKVEVVEK KKRRYRTKFT AQQKEKMLAF ATKAGWRMQK  180
LDEHAVERLC QELGIERRVL KVWMHNNKHN YLPSNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-221532101875ZF-HD homeobox family protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1149153KKKRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I00022.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010027493.11e-163PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotQ2QW441e-51ZHD3_ORYSJ; Zinc-finger homeodomain protein 3
TrEMBLA0A059AK371e-163A0A059AK37_EUCGR; Uncharacterized protein
STRINGGLYMA20G35690.21e-62(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM51662549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.11e-46homeobox protein 22